CDKN2A Peptide - middle region
CDKN2A Peptide - middle region
Product Specifications
Product Name Alternative
ARF, MLM, P14, P16, P19, CMM2, INK4, MTS1, TP16, CDK4I, CDKN2, INK4A, MTS-1, P14ARF, P19ARF, P16INK4, P16INK4A, P16-INK4A
UniProt
P42771
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_000068.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1189588-01 0.02 mg (E-Coli)
Recombinant Treponema pallidum subsp. pallidum Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1189588-02 0.02 mg (Yeast)
Recombinant Treponema pallidum subsp. pallidum Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1189588-03 0.1 mg (E-Coli)
Recombinant Treponema pallidum subsp. pallidum Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1189588-04 0.1 mg (Yeast)
Recombinant Treponema pallidum subsp. pallidum Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1189588-05 0.02 mg (Baculovirus)
Recombinant Treponema pallidum subsp. pallidum Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details MBS1189588-06 0.02 mg (Mammalian-Cell)
Recombinant Treponema pallidum subsp. pallidum Peptide chain release factor 1 (prfA)
Sign In for Pricing
View Details