Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2A Peptide - middle region

CDKN2A Peptide - middle region

Product Specifications

Product Name Alternative

ARF, MLM, P14, P16, P19, CMM2, INK4, MTS1, TP16, CDK4I, CDKN2, INK4A, MTS-1, P14ARF, P19ARF, P16INK4, P16INK4A, P16-INK4A

UniProt

P42771

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VHL, CT (Von Hippel-Lindau Disease Tumor Suppressor, pVHL, Protein G7) (MaxLight 490) discontinued
V2640-03J-ML490 100 µL

VHL, CT (Von Hippel-Lindau Disease Tumor Suppressor, pVHL, Protein G7) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Peptidylprolyl isomerase (cyclophilin) -like 4
327924 100 µL

Peptidylprolyl isomerase (cyclophilin) -like 4

Sign In for Pricing
View Details
PCDHA6, CT (PCDHA6, CNRS2, Protocadherin alpha-6) (MaxLight 750) discontinued
039735-ML750 100 µL

PCDHA6, CT (PCDHA6, CNRS2, Protocadherin alpha-6) (MaxLight 750) discontinued

Sign In for Pricing
View Details
AMPH Recombinant Protein (Rat)
RP190088 100 µg

AMPH Recombinant Protein (Rat)

Sign In for Pricing
View Details
Caveolin-1 Rabbit Polyclonal Antibody (BF350)
orb2513616 100 µL

Caveolin-1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
CKMT2 Antibody
MBS9412874-01 0.05 mL

CKMT2 Antibody

Sign In for Pricing
View Details