What is the catalog number for CD14 Peptide - middle region?

The catalog number for CD14 Peptide - middle region is orb2001296.

What sizes are available for CD14 Peptide - middle region?

CD14 Peptide - middle region is available in the following size(s): 100 µg.

Is CD14 Peptide - middle region in stock?

CD14 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CD14 Peptide - middle region

Product Specifications

UniProt

P08571

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000582.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS7015855-01 0.02 mg

Recombinant Rhomboid protease glpG (glpG)

Sign In for Pricing

View Details

MBS7015855-02 0.1 mg

Recombinant Rhomboid protease glpG (glpG)

Sign In for Pricing

View Details

MBS7015855-03 5x 0.1 mg

Recombinant Rhomboid protease glpG (glpG)

Sign In for Pricing

View Details

RC219733 10 µg

NRAMP1 (SLC11A1) (NM_000578) Human Tagged ORF Clone

Sign In for Pricing

View Details

OAAF00304-100UG 100 µg

PPP1R1B Antibody (Phospho-Thr34)

Sign In for Pricing

View Details

E-EL-RB1540-01 24 Tests

Rabbit MMP-2-Matrix Metalloproteinase 2- ELISA Kit

Sign In for Pricing

View Details