What is the catalog number for CD14 Peptide - middle region?

The catalog number for CD14 Peptide - middle region is orb2001296.

What sizes are available for CD14 Peptide - middle region?

CD14 Peptide - middle region is available in the following size(s): 100 µg.

Is CD14 Peptide - middle region in stock?

CD14 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CD14 Peptide - middle region

Product Specifications

UniProt

P08571

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000582.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K7153907 1.0 µg DNA

Olr526 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing

View Details

NBP2-74851FR 0.1 mL

Mouse Monoclonal Von Hippel Lindau Antibody (OTI1E1) [DyLight 680]

Sign In for Pricing

View Details

K4863802 1.0 µg DNA

Rps18 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing

View Details

E913426 100 µL

PHF11 Polyclonal Antibody

Sign In for Pricing

View Details

K3518801 3x 1.0 µg

MICU3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing

View Details

SC324556 10 µg

GLUT12 (SLC2A12) (NM_145176) Human Untagged Clone

Sign In for Pricing

View Details