What is the catalog number for PDLIM4 Peptide - N-terminal region?

The catalog number for PDLIM4 Peptide - N-terminal region is orb2001292.

What sizes are available for PDLIM4 Peptide - N-terminal region?

PDLIM4 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is PDLIM4 Peptide - N-terminal region in stock?

PDLIM4 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PDLIM4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RIL

UniProt

P50479

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001124499.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAING

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-00955 0.1 mL

Mouse Monoclonal Tropomodulin 1 Antibody (OTI2C2)

Sign In for Pricing

View Details

NBP2-60237FR 0.1 mL

Mouse Monoclonal Rab7a Antibody (10E4) [DyLight 680]

Sign In for Pricing

View Details

1032220 100 100 g

N-Cetyl-N, N, N-Trimethyl Ammonium Bromide AR

Sign In for Pricing

View Details

AP87323-01 50 µg

Resistin-like alpha

Sign In for Pricing

View Details

AP87323-02 100 µg

Resistin-like alpha

Sign In for Pricing

View Details

AP87323-03 1 mg

Resistin-like alpha

Sign In for Pricing

View Details