Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM4 Peptide - N-terminal region

PDLIM4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RIL

UniProt

P50479

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001124499.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAING

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Histone H3 Ready-To-Use IHC Kit
orb1610349 50 Tests

Mouse Histone H3 Ready-To-Use IHC Kit

Sign In for Pricing
View Details
Rat Spindlin-1, SPIN1 ELISA Kit
MBS9316984-01 48 Well

Rat Spindlin-1, SPIN1 ELISA Kit

Sign In for Pricing
View Details
Rat Spindlin-1, SPIN1 ELISA Kit
MBS9316984-02 96 Well

Rat Spindlin-1, SPIN1 ELISA Kit

Sign In for Pricing
View Details
Rat Spindlin-1, SPIN1 ELISA Kit
MBS9316984-03 5x 96 Well

Rat Spindlin-1, SPIN1 ELISA Kit

Sign In for Pricing
View Details
Rat Spindlin-1, SPIN1 ELISA Kit
MBS9316984-04 10x 96 Well

Rat Spindlin-1, SPIN1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein FdhD (fdhD)
MBS1017182-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Protein FdhD (fdhD)

Sign In for Pricing
View Details