What is the catalog number for INA Peptide - middle region?

The catalog number for INA Peptide - middle region is orb2001287.

What sizes are available for INA Peptide - middle region?

INA Peptide - middle region is available in the following size(s): 100 µg.

Is INA Peptide - middle region in stock?

INA Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

INA Peptide - middle region

Product Specifications

Product Name Alternative

NEF5, NF-66, TXBP-1

UniProt

Q16352

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116116.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BZ34159 1 Vial

PEnCMV-LRPAP1 (human) -3xFLAG-SV40-Neo

Sign In for Pricing

View Details

NBP2-26649AF532 0.1 mL

Mouse Monoclonal QA1b Antibody (6A8.6F10.1A6) [Alexa Fluor 532]

Sign In for Pricing

View Details

NBP1-52648AF594 0.1 mL

Rabbit Polyclonal E2F7 Antibody [Alexa Fluor 594]

Sign In for Pricing

View Details

33929056 1.0 mL

OLR1425 Adenovirus (Rat)

Sign In for Pricing

View Details

A08614-2 100 µg/Vial

Anti-NUP35 Antibody Picoband®

Sign In for Pricing

View Details

orb383532-01 100 µg

Mouse B7-1 Protein, His Tag

Sign In for Pricing

View Details