Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INA Peptide - middle region

INA Peptide - middle region

Product Specifications

Product Name Alternative

NEF5, NF-66, TXBP-1

UniProt

Q16352

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116116.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLS Coverslips No 1.5 20x20mm
MIC3122 200 / PCK

SLS Coverslips No 1.5 20x20mm

Sign In for Pricing
View Details
Melanophilin Antibody
MBS9521518-01 0.04 mL

Melanophilin Antibody

Sign In for Pricing
View Details
Melanophilin Antibody
MBS9521518-02 0.1 mL

Melanophilin Antibody

Sign In for Pricing
View Details
Melanophilin Antibody
MBS9521518-03 0.2 mL

Melanophilin Antibody

Sign In for Pricing
View Details
Melanophilin Antibody
MBS9521518-04 5x 0.2 mL

Melanophilin Antibody

Sign In for Pricing
View Details
PEPCK2 (Phosphoenolpyruvate Carboxykinase [GTP], Mitochondrial, PEPCK-M, Phosphoenolpyruvate Carboxylase, PCK2) (MaxLight 550)
131146-ML550 100 µL

PEPCK2 (Phosphoenolpyruvate Carboxykinase [GTP], Mitochondrial, PEPCK-M, Phosphoenolpyruvate Carboxylase, PCK2) (MaxLight 550)

Sign In for Pricing
View Details