Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICB Peptide - middle region

MICB Peptide - middle region

Product Specifications

Product Name Alternative

PERB11.2

UniProt

Q29980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001276089.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE8A Assay Kit, BioAssayTM
137353 96 Tests

PDE8A Assay Kit, BioAssayTM

Sign In for Pricing
View Details
Rat Synaptophysin ELISA Kit
MBS9428184-01 96 Tests

Rat Synaptophysin ELISA Kit

Sign In for Pricing
View Details
Rat Synaptophysin ELISA Kit
MBS9428184-02 5x 96 Tests

Rat Synaptophysin ELISA Kit

Sign In for Pricing
View Details
POLG2 Antibody (FITC)
orb351567-01 50 µg

POLG2 Antibody (FITC)

Sign In for Pricing
View Details
POLG2 Antibody (FITC)
orb351567-02 100 µg

POLG2 Antibody (FITC)

Sign In for Pricing
View Details
Phospho-DAXX (Ser671) Rabbit Polyclonal Antibody (APC-Cy7)
orb2412306 100 µL

Phospho-DAXX (Ser671) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details