Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICB Peptide - middle region

MICB Peptide - middle region

Product Specifications

Product Name Alternative

PERB11.2

UniProt

Q29980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001276089.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N, N-Didesethyl Sunitinib Hydrochloride discontinued
009374 1 mg

N, N-Didesethyl Sunitinib Hydrochloride discontinued

Sign In for Pricing
View Details
Lentiviral human PPP1R13L shRNA (UAS) - Lentiviral human PPP1R13L shRNA (UAS, GFP) (100)
GTR15313260 1 Vial

Lentiviral human PPP1R13L shRNA (UAS) - Lentiviral human PPP1R13L shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
SNRNP35 Polyclonal Antibody
MBS9431825-01 0.05 mL

SNRNP35 Polyclonal Antibody

Sign In for Pricing
View Details
SNRNP35 Polyclonal Antibody
MBS9431825-02 0.1 mL

SNRNP35 Polyclonal Antibody

Sign In for Pricing
View Details
SNRNP35 Polyclonal Antibody
MBS9431825-03 5x 0.1 mL

SNRNP35 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human DCTD Protein
ARP1838-01 10 µg

Recombinant Human DCTD Protein

Sign In for Pricing
View Details