What is the catalog number for MR1 Peptide - N-terminal region?

The catalog number for MR1 Peptide - N-terminal region is orb2001280.

What sizes are available for MR1 Peptide - N-terminal region?

MR1 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is MR1 Peptide - N-terminal region in stock?

MR1 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HLALS

UniProt

Q95460

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001181928.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

423101-01 10 g

3- (Bromomethyl) toluene

Sign In for Pricing

View Details

423101-02 25 g

3- (Bromomethyl) toluene

Sign In for Pricing

View Details

orb1731555 100 µL

PCGF6 Antibody

Sign In for Pricing

View Details

MBS6227840-01 0.1 mL

GRK7 (G Protein-Coupled Receptor Kinase 7, GPRK7) (MaxLight 650)

Sign In for Pricing

View Details

MBS6227840-02 5x 0.1 mL

GRK7 (G Protein-Coupled Receptor Kinase 7, GPRK7) (MaxLight 650)

Sign In for Pricing

View Details

abx337334-01 20 µg

Protein Wnt-8a (WNT8A) Antibody (FITC)

Sign In for Pricing

View Details