Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MR1 Peptide - N-terminal region

MR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HLALS

UniProt

Q95460

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001181928.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r177 AAV Vector (Mouse) (CMV)
49581104 1 µg

Vmn1r177 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
RMND5A polyclonal antibody
orb648087-01 50 μL

RMND5A polyclonal antibody

Sign In for Pricing
View Details
RMND5A polyclonal antibody
orb648087-02 100 µL

RMND5A polyclonal antibody

Sign In for Pricing
View Details
RMND5A polyclonal antibody
orb648087-03 200 µL

RMND5A polyclonal antibody

Sign In for Pricing
View Details
Legumain Polyclonal Antibody, PE-Cy7 Conjugated
bs-3907R-PE-Cy7 100 µL

Legumain Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
C20orf7 (NDUFAF5) CytoSection
TS417112P5 25 Slides

C20orf7 (NDUFAF5) CytoSection

Sign In for Pricing
View Details