SSTR5 Peptide - C-terminal region
SSTR5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SS-5-R
UniProt
P35346
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001044.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
222944-01 50 µL
GIPC2 (GIPC 2, GIPC PDZ Domain Containing Family, Member 2, GIPC2, GIPC2, Likely ortholog of mouse semaF Cytoplasmic Domain Associated Protein 2, PDZ Domain Protein GIPC2, PDZ Domain-Containing Protein GIPC2, SemaF Cytoplasmic Domain Associated Protein 2, Semaphorin Cytoplasmic Domain Associated Protein 2, SEMCAP 2, SEMCAP2) discontinued
Sign In for Pricing
View Details 222944-02 100 µL
GIPC2 (GIPC 2, GIPC PDZ Domain Containing Family, Member 2, GIPC2, GIPC2, Likely ortholog of mouse semaF Cytoplasmic Domain Associated Protein 2, PDZ Domain Protein GIPC2, PDZ Domain-Containing Protein GIPC2, SemaF Cytoplasmic Domain Associated Protein 2, Semaphorin Cytoplasmic Domain Associated Protein 2, SEMCAP 2, SEMCAP2) discontinued
Sign In for Pricing
View Details 