Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR5 Peptide - C-terminal region

SSTR5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SS-5-R

UniProt

P35346

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001044.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Mitochondrial complex I (complex I) ELISA Kit
SL0123FI-01 48 Tests

Fish Mitochondrial complex I (complex I) ELISA Kit

Sign In for Pricing
View Details
Fish Mitochondrial complex I (complex I) ELISA Kit
SL0123FI-02 96 Tests

Fish Mitochondrial complex I (complex I) ELISA Kit

Sign In for Pricing
View Details
Human NPFFR2 qPCR Primer Pair
QH32657S 200 Tests

Human NPFFR2 qPCR Primer Pair

Sign In for Pricing
View Details
CCR6 Cell Line (Rat Glioma)
116065R 100 µg

CCR6 Cell Line (Rat Glioma)

Sign In for Pricing
View Details
Mouse FAM166B siRNA
abx916112-01 15 nmol

Mouse FAM166B siRNA

Sign In for Pricing
View Details
Mouse FAM166B siRNA
abx916112-02 30 nmol

Mouse FAM166B siRNA

Sign In for Pricing
View Details