Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTO1 Peptide - middle region

GSTO1 Peptide - middle region

Product Specifications

Product Name Alternative

P28, SPG-R, GSTO 1-1, GSTTLp28, HEL-S-21

UniProt

P78417

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001177931.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), Biotin conjugate, 0.1mg/mL
BNCB0270-500 1x 500 µL

Fibronectin (HFN7.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS806722 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
DAP Kinase 1 Recombinant Mouse monoclonal Antibody
HA610051 100 µg

DAP Kinase 1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD122/IL-2RB Protein (Fc Tag)
PKSH031479-01 100 µg

Recombinant Human CD122/IL-2RB Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD122/IL-2RB Protein (Fc Tag)
PKSH031479-02 1 mg

Recombinant Human CD122/IL-2RB Protein (Fc Tag)

Sign In for Pricing
View Details
Oxetan-3-yl (2,2,2-Trifluoroethyl) Carbonate
TRC-O846605-50MG 50 mg

Oxetan-3-yl (2,2,2-Trifluoroethyl) Carbonate

Sign In for Pricing
View Details