Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTO1 Peptide - middle region

GSTO1 Peptide - middle region

Product Specifications

Product Name Alternative

P28, SPG-R, GSTO 1-1, GSTTLp28, HEL-S-21

UniProt

P78417

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001177931.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FBXL4 activation kit by CRISPRa
GA108811 1 Kit

Human FBXL4 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Fadd activation kit by CRISPRa
GA201350 1 Kit

Mouse Fadd activation kit by CRISPRa

Sign In for Pricing
View Details
LYSMD1 (NM_001136543) Human Over-expression Lysate
LC427918 20 µg

LYSMD1 (NM_001136543) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB611193 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Supervillin (SVIL) Human Gene Knockout Kit (CRISPR)
KN416323 1 Kit

Supervillin (SVIL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2287R), CF647 conjugate, 0.1mg/mL
BNC472287-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2287R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details