Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALPL Peptide - middle region

ALPL Peptide - middle region

Product Specifications

Product Name Alternative

HOPS, TNAP, APTNAP, TNSALP, AP-TNAP

UniProt

P05186

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000469.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC41 (NM_006369) Human Over-expression Lysate
LS010489 100 µg

LRRC41 (NM_006369) Human Over-expression Lysate

Sign In for Pricing
View Details
UBE2L3 (NM_003347) Human Recombinant Protein
PROTP68036 20 µg

UBE2L3 (NM_003347) Human Recombinant Protein

Sign In for Pricing
View Details
PPP3CA Antibody - middle region : Biotin (ARP51338_P050-Biotin)
ARP51338_P050-Biotin 100 µL

PPP3CA Antibody - middle region : Biotin (ARP51338_P050-Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Tarbp2 shRNA (UAS) - Lentiviral mouse Tarbp2 shRNA (UAS, RFP) plasmid
GTR15213445 1 Vial

Lentiviral mouse Tarbp2 shRNA (UAS) - Lentiviral mouse Tarbp2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CTNNB1 (Catenin (Cadherin-Associated Protein), beta 1, 88kD, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923) (HRP)
MBS6180531-01 0.1 mL

CTNNB1 (Catenin (Cadherin-Associated Protein), beta 1, 88kD, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923) (HRP)

Sign In for Pricing
View Details
CTNNB1 (Catenin (Cadherin-Associated Protein), beta 1, 88kD, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923) (HRP)
MBS6180531-02 5x 0.1 mL

CTNNB1 (Catenin (Cadherin-Associated Protein), beta 1, 88kD, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923) (HRP)

Sign In for Pricing
View Details