Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR1B Peptide - middle region

ACVR1B Peptide - middle region

Product Specifications

Product Name Alternative

ALK4, SKR2, ACTRIB, ACVRLK4

UniProt

P36896

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004293.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQRT

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transforming Growth Factor Beta Receptor I (TGFbR1) ELISA Kit
QY-E00114 96 Tests

Human Transforming Growth Factor Beta Receptor I (TGFbR1) ELISA Kit

Sign In for Pricing
View Details
Semaphorin 3B/SEMA3B Mouse Monoclonal Antibody (Biotin)
orb2598153 100 µg

Semaphorin 3B/SEMA3B Mouse Monoclonal Antibody (Biotin)

Sign In for Pricing
View Details
ATP5LP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV719390 1.0 µg DNA

ATP5LP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
P2RX2 Rabbit pAb
E2507078 100 µL

P2RX2 Rabbit pAb

Sign In for Pricing
View Details
RGPS2 Rabbit Polyclonal Antibody
MBS9516601-01 0.05 mL

RGPS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGPS2 Rabbit Polyclonal Antibody
MBS9516601-02 0.1 mL

RGPS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details