DPP8 Peptide - C-terminal region
DPP8 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DP8, DPRP1, MST097, MSTP097, MSTP135, MSTP141
UniProt
Q6V1X1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_060213.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9398367-01 48 Well
Human Nucleotide-Binding Oligomerization Domain-Containing Protein 1 (NOD1) ELISA Kit
Sign In for Pricing
View Details MBS9398367-02 96 Well
Human Nucleotide-Binding Oligomerization Domain-Containing Protein 1 (NOD1) ELISA Kit
Sign In for Pricing
View Details MBS9398367-03 5x 96 Well
Human Nucleotide-Binding Oligomerization Domain-Containing Protein 1 (NOD1) ELISA Kit
Sign In for Pricing
View Details MBS9398367-04 10x 96 Well
Human Nucleotide-Binding Oligomerization Domain-Containing Protein 1 (NOD1) ELISA Kit
Sign In for Pricing
View Details