Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPP8 Peptide - C-terminal region

DPP8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DP8, DPRP1, MST097, MSTP097, MSTP135, MSTP141

UniProt

Q6V1X1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060213.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRP54 Antibody
A35632-50UG 50 µg

SRP54 Antibody

Sign In for Pricing
View Details
VAMP1 (NM_199245) Human Tagged ORF Clone
RC205125 10 µg

VAMP1 (NM_199245) Human Tagged ORF Clone

Sign In for Pricing
View Details
RIPK5 (DSTYK) (NM_199462) Human Tagged ORF Clone Lentiviral Particle
RC208819L1V 200 µL

RIPK5 (DSTYK) (NM_199462) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human TNFa/TNFSF2/TNF Protein, No Tag
E40KMH1820 20 µg

Recombinant Human TNFa/TNFSF2/TNF Protein, No Tag

Sign In for Pricing
View Details
Hsa-miR-224-5p miRNA Agomir
CMJ0085-01 5 nmol

Hsa-miR-224-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-224-5p miRNA Agomir
CMJ0085-02 10 nmol

Hsa-miR-224-5p miRNA Agomir

Sign In for Pricing
View Details