What is the catalog number for CEACAM8 Peptide - middle region?

The catalog number for CEACAM8 Peptide - middle region is orb2001263.

What sizes are available for CEACAM8 Peptide - middle region?

CEACAM8 Peptide - middle region is available in the following size(s): 100 µg.

Is CEACAM8 Peptide - middle region in stock?

CEACAM8 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CEACAM8 Peptide - middle region

Product Specifications

Product Name Alternative

CD67, CGM6, CD66b, NCA-95

UniProt

P31997

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001807.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

18644035 100 µg

DTNB Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing

View Details

orb2622963 100 µg

CD63 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing

View Details

MK203828 1 Kit

Klrk1 Mouse qPCR Template Standard (NM_033078)

Sign In for Pricing

View Details

abx493331-01 96 Tests

Mouse Microtubule-Associated Protein Tau (MAPT) CLIA Kit

Sign In for Pricing

View Details

abx493331-02 5x 96 Tests

Mouse Microtubule-Associated Protein Tau (MAPT) CLIA Kit

Sign In for Pricing

View Details

abx493331-03 10x 96 Tests

Mouse Microtubule-Associated Protein Tau (MAPT) CLIA Kit

Sign In for Pricing

View Details