Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM8 Peptide - middle region

CEACAM8 Peptide - middle region

Product Specifications

Product Name Alternative

CD67, CGM6, CD66b, NCA-95

UniProt

P31997

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001807.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish HNRNPD Antibody Picoband® APC Conjugated
AZA0A8M9QC46-APC 100 µg/Vial

Anti-Zebrafish HNRNPD Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
Snapc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6106707 1.0 µg DNA

Snapc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mouse LMNA (Lamin A/C) ELISA Kit
ELK6414-01 48 Tests

Mouse LMNA (Lamin A/C) ELISA Kit

Sign In for Pricing
View Details
Mouse LMNA (Lamin A/C) ELISA Kit
ELK6414-02 96 Tests

Mouse LMNA (Lamin A/C) ELISA Kit

Sign In for Pricing
View Details
Mouse LMNA (Lamin A/C) ELISA Kit
ELK6414-03 5x 96 Tests

Mouse LMNA (Lamin A/C) ELISA Kit

Sign In for Pricing
View Details
III Antibody, FITC conjugated
A50060-50UG 50 µg

III Antibody, FITC conjugated

Sign In for Pricing
View Details