Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRD5A1 Peptide - middle region

SRD5A1 Peptide - middle region

Product Specifications

Product Name Alternative

S5AR 1

UniProt

P18405

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001038.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Periostin Antibody / POSTN
V5651-100UG 100 µg

Periostin Antibody / POSTN

Sign In for Pricing
View Details
Hydrofluoric Acid 48% Novopur For Trace Metal Analysis
NVP002 01000 1 L

Hydrofluoric Acid 48% Novopur For Trace Metal Analysis

Sign In for Pricing
View Details
DMPK Antibody Blocking peptide
orb1454220 500 µg

DMPK Antibody Blocking peptide

Sign In for Pricing
View Details
Tipranavir - Bio-X TM
BT300133 2 mg

Tipranavir - Bio-X TM

Sign In for Pricing
View Details
(D-Ala²,N-Me-Phe⁴,glycinol⁵)-Enkephalin
4007829.01 100 mg

(D-Ala²,N-Me-Phe⁴,glycinol⁵)-Enkephalin

Sign In for Pricing
View Details
Neprilysin-Like Protease-a, Mouse (NEPL-a), Control Peptide
MBS658638-01 0.1 mg

Neprilysin-Like Protease-a, Mouse (NEPL-a), Control Peptide

Sign In for Pricing
View Details