Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRD5A1 Peptide - middle region

SRD5A1 Peptide - middle region

Product Specifications

Product Name Alternative

S5AR 1

UniProt

P18405

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001038.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD99L2 Protein (His Tag)
PKSM040635 100 µg

Recombinant Mouse CD99L2 Protein (His Tag)

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF640R conjugate, 0.1mg/mL
BNC401553-100 1x 100 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Mouse OxLDL (Oxidized Low Density Lipoprotein) ELISA Kit
E-UNEL-M0165-01 5x 96 Tests

Uncoated Mouse OxLDL (Oxidized Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse OxLDL (Oxidized Low Density Lipoprotein) ELISA Kit
E-UNEL-M0165-02 15x 96 Tests

Uncoated Mouse OxLDL (Oxidized Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details
FAM-xtra™ Phosphoramidite
6037-AAT 50 µmole

FAM-xtra™ Phosphoramidite

Sign In for Pricing
View Details
2,4-Xylidine-d6
TRC-X749692-25MG 25 mg

2,4-Xylidine-d6

Sign In for Pricing
View Details