What is the catalog number for UCN3 Peptide - middle region?

The catalog number for UCN3 Peptide - middle region is orb2001257.

What sizes are available for UCN3 Peptide - middle region?

UCN3 Peptide - middle region is available in the following size(s): 100 µg.

Is UCN3 Peptide - middle region in stock?

UCN3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

UCN3 Peptide - middle region

Product Specifications

Product Name Alternative

SCP, SPC, UCNIII

UniProt

Q969E3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_444277.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR25549-01 500 mg

2- (3-oxo-1,3-dihydroisobenzofuran-1-yliden) acetic acid

Sign In for Pricing

View Details

OR25549-02 1 g

2- (3-oxo-1,3-dihydroisobenzofuran-1-yliden) acetic acid

Sign In for Pricing

View Details

OR25549-03 5 g

2- (3-oxo-1,3-dihydroisobenzofuran-1-yliden) acetic acid

Sign In for Pricing

View Details

OR25549-04 10 g

2- (3-oxo-1,3-dihydroisobenzofuran-1-yliden) acetic acid

Sign In for Pricing

View Details

OR25549-05 25 g

2- (3-oxo-1,3-dihydroisobenzofuran-1-yliden) acetic acid

Sign In for Pricing

View Details

NB100-79802B 0.1 mL

Rabbit Polyclonal CRM1 Antibody [Biotin]

Sign In for Pricing

View Details