Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR1 Peptide - N-terminal region

TAAR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TA1, TAR1, TRAR1

UniProt

Q96RJ0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_612200.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dectin 1 (CLEC7A) Human Gene Knockout Kit (CRISPR)
KN214107LP 1 Kit

Dectin 1 (CLEC7A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS620123 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details
PVRL1 (NECTIN1) Rabbit Polyclonal Antibody
TA392484 100 µL

PVRL1 (NECTIN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ReadiView™ biotin hydrazide
3055-AAT 5 mg

ReadiView™ biotin hydrazide

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF594 conjugate, 0.1mg/mL
BNC941997-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704708 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details