Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAD2 Peptide - N-terminal region

GAD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GAD65

UniProt

Q05329

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000809.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (GA-5), CF740 conjugate, 0.1mg/mL
BNC740167-500 1x 500 µL

GFAP (GA-5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/798), CF640R conjugate, 0.1mg/mL
BNC400798-100 1x 100 µL

Chromogranin A (CHGA/798), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C3 (C3) (NM_000064) Human Over-expression Lysate
LC424934 20 µg

Complement C3 (C3) (NM_000064) Human Over-expression Lysate

Sign In for Pricing
View Details
PI 3 Kinase p85 beta (PIK3R2) Rabbit Polyclonal Antibody
TA379943 100 µL

PI 3 Kinase p85 beta (PIK3R2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), 1mg/mL
BNUM2383-50 1x 50 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), 1mg/mL

Sign In for Pricing
View Details
CLPP Antibody
OC-419-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details