Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAD2 Peptide - N-terminal region

GAD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GAD65

UniProt

Q05329

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000809.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SIRPA/CD172a Protein (MIgG2a Tag)
PKSM041146-01 10 µg

Recombinant Mouse SIRPA/CD172a Protein (MIgG2a Tag)

Sign In for Pricing
View Details
Recombinant Mouse SIRPA/CD172a Protein (MIgG2a Tag)
PKSM041146-02 50 µg

Recombinant Mouse SIRPA/CD172a Protein (MIgG2a Tag)

Sign In for Pricing
View Details
Cyclin D2 (CCND2/2620), 0.2mg/mL
BNUB2620-500 1x 500 µL

Cyclin D2 (CCND2/2620), 0.2mg/mL

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF488A conjugate, 0.1mg/mL
BNC881856-500 1x 500 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Amplite® Fluorimetric Lithium Ion Quantification Kit
21351-AAT 100 Tests

Amplite® Fluorimetric Lithium Ion Quantification Kit

Sign In for Pricing
View Details
SPINK6 (NM_205841) Human Over-expression Lysate
LC404267 20 µg

SPINK6 (NM_205841) Human Over-expression Lysate

Sign In for Pricing
View Details