Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G7 Peptide - middle region

PLA2G7 Peptide - middle region

Product Specifications

Product Name Alternative

PAFAD, PAFAH, LP-PLA2, LDL-PLA2

UniProt

Q13093

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001161829.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL18BP Protein (His Tag)
PDMH100442-01 20 µg

Recombinant Human IL18BP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL18BP Protein (His Tag)
PDMH100442-02 100 µg

Recombinant Human IL18BP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL18BP Protein (His Tag)
PDMH100442-03 500 µg

Recombinant Human IL18BP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL18BP Protein (His Tag)
PDMH100442-04 1 mg

Recombinant Human IL18BP Protein (His Tag)

Sign In for Pricing
View Details
Human GLUD2 activation kit by CRISPRa
GA101834 1 Kit

Human GLUD2 activation kit by CRISPRa

Sign In for Pricing
View Details
ATP5PF (NM_001003703) Human Over-expression Lysate
LC423989 20 µg

ATP5PF (NM_001003703) Human Over-expression Lysate

Sign In for Pricing
View Details