Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCGR Peptide - middle region

GCGR Peptide - middle region

Product Specifications

Product Name Alternative

GGR, GL-R

UniProt

P47871

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000151.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAAM2 Human Gene Knockout Kit (CRISPR)
KN420800 1 Kit

DAAM2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712287 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Cytokeratin 18 (DA7), CF647 conjugate, 0.1mg/mL
BNC470198-500 1x 500 µL

Cytokeratin 18 (DA7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF488A conjugate, 0.1mg/mL
BNC881100-500 1x 500 µL

Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
A530032D15Rik Mouse Gene Knockout Kit (CRISPR)
KN500555 1 Kit

A530032D15Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BAGE2 Antibody
8C14675-AAT 50 µg

BAGE2 Antibody

Sign In for Pricing
View Details