Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCGR Peptide - middle region

GCGR Peptide - middle region

Product Specifications

Product Name Alternative

GGR, GL-R

UniProt

P47871

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000151.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMTOR1 Rabbit Polyclonal Antibody
TA377950 100 µL

LAMTOR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human BPIFB1/LPLUNC1 Protein (His Tag)
PKSH030668 50 µg

Recombinant Human BPIFB1/LPLUNC1 Protein (His Tag)

Sign In for Pricing
View Details
Human BRG1 (SMARCA4) activation kit by CRISPRa
GA104511 1 Kit

Human BRG1 (SMARCA4) activation kit by CRISPRa

Sign In for Pricing
View Details
Acacb Mouse Gene Knockout Kit (CRISPR)
KN500685 1 Kit

Acacb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-O-Levulinoyl Resveratrol Diacetate
TRC-L379700-10MG 10 mg

1-O-Levulinoyl Resveratrol Diacetate

Sign In for Pricing
View Details
Antibody Coating Buffer, 5X
645 500 mL

Antibody Coating Buffer, 5X

Sign In for Pricing
View Details