Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14B Peptide - middle region

CDC14B Peptide - middle region

Product Specifications

Product Name Alternative

CDC14B3, Cdc14B1, Cdc14B2, hCDC14B

UniProt

O60729

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001070649.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-α-Me-Leu-OH
4040839.0005 5 g

Fmoc-α-Me-Leu-OH

Sign In for Pricing
View Details
IL1F10/IL38 Rabbit Polyclonal Antibody (RBITC)
orb1071815 100 µL

IL1F10/IL38 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
SMAD1 Protein Vector (Rat) (pPM-C-HA)
PV306672 500 ng

SMAD1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
HRAS (HRAS1, GTPase HRas, H-Ras-1, Ha-Ras, Transforming Protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally Processed) (MaxLight 550)
217440-ML550 100 µL

HRAS (HRAS1, GTPase HRas, H-Ras-1, Ha-Ras, Transforming Protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally Processed) (MaxLight 550)

Sign In for Pricing
View Details
Cytochrome P450 2E1/CYP2E1 Mouse Monoclonal Antibody (Fluoro488)
orb3085704 100 µg

Cytochrome P450 2E1/CYP2E1 Mouse Monoclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Recombinant Thermotoga maritima Glutamine amidotransferase subunit pdxT (pdxT)
MBS1461065-01 0.02 mg (E-Coli)

Recombinant Thermotoga maritima Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details