Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCN2 Peptide - middle region

CLCN2 Peptide - middle region

Product Specifications

Product Name Alternative

CLC2, ECA2, ECA3, EGI3, EGMA, EJM6, EJM8, CIC-2, EGI11, LKPAT, clC-2

UniProt

P51788

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001164558.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILPVMIAVILANAVAQSLQPSLYDSIIRIKKLPYLPELGWGRHQQYRVRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chk2 (Phospho-Thr383) Antibody
orb191541-01 50 μL

Chk2 (Phospho-Thr383) Antibody

Sign In for Pricing
View Details
Chk2 (Phospho-Thr383) Antibody
orb191541-02 100 µL

Chk2 (Phospho-Thr383) Antibody

Sign In for Pricing
View Details
TGFA Antibody
orb388701-01 20 µg

TGFA Antibody

Sign In for Pricing
View Details
TGFA Antibody
orb388701-02 100 µg

TGFA Antibody

Sign In for Pricing
View Details
TGFA Antibody
orb388701-03 100 ug (without BSA and Azide)

TGFA Antibody

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia Urease accessory protein UreD (ureD)
MBS1246590-01 0.02 mg (E-Coli)

Recombinant Burkholderia cenocepacia Urease accessory protein UreD (ureD)

Sign In for Pricing
View Details