CLCN2 Peptide - middle region
CLCN2 Peptide - middle region
Product Specifications
Product Name Alternative
CLC2, ECA2, ECA3, EGI3, EGMA, EJM6, EJM8, CIC-2, EGI11, LKPAT, clC-2
UniProt
P51788
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001164558.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILPVMIAVILANAVAQSLQPSLYDSIIRIKKLPYLPELGWGRHQQYRVRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1035097-01 0.02 mg (E-Coli)
Recombinant Pseudomonas stutzeri 5'-nucleotidase surE (surE)
Sign In for Pricing
View Details MBS1035097-02 0.1 mg (E-Coli)
Recombinant Pseudomonas stutzeri 5'-nucleotidase surE (surE)
Sign In for Pricing
View Details MBS1035097-03 0.02 mg (Baculovirus)
Recombinant Pseudomonas stutzeri 5'-nucleotidase surE (surE)
Sign In for Pricing
View Details MBS1035097-04 0.02 mg (Mammalian-Cell)
Recombinant Pseudomonas stutzeri 5'-nucleotidase surE (surE)
Sign In for Pricing
View Details MBS1035097-05 1 mg (E-Coli)
Recombinant Pseudomonas stutzeri 5'-nucleotidase surE (surE)
Sign In for Pricing
View Details MBS1035097-06 0.1 mg (Baculovirus)
Recombinant Pseudomonas stutzeri 5'-nucleotidase surE (surE)
Sign In for Pricing
View Details