Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK5 Peptide - middle region

MAPKAPK5 Peptide - middle region

Product Specifications

Product Name Alternative

MK5, MK-5, PRAK, MAPKAP-K5

UniProt

Q8IW41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003659.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFDP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2362306 1.0 µg DNA

TFDP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046896-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046896-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046896-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046896-04 1 mL

Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046896-05 5 mL

Cy3-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details