Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK5 Peptide - middle region

MAPKAPK5 Peptide - middle region

Product Specifications

Product Name Alternative

MK5, MK-5, PRAK, MAPKAP-K5

UniProt

Q8IW41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003659.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ap3s1 (NM_001106933) Rat Tagged Lenti ORF Clone
RR205640L3 10 µg

Ap3s1 (NM_001106933) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cenps (NM_027263) Mouse Recombinant Protein
E45M43464M5 20 µg

Cenps (NM_027263) Mouse Recombinant Protein

Sign In for Pricing
View Details
PinPoint Integrase Expression Plasmid
PIN200A-1 10 µg

PinPoint Integrase Expression Plasmid

Sign In for Pricing
View Details
Recombinant Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L) , partial
MBS7079322 Inquire

Recombinant Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L) , partial

Sign In for Pricing
View Details
Anti-Fas Ligand/FASLG Antibody
PA1576 100 µg/Vial

Anti-Fas Ligand/FASLG Antibody

Sign In for Pricing
View Details
Recombinant Human Mesothelin Protein, His Tag
KMP1688 50 µg

Recombinant Human Mesothelin Protein, His Tag

Sign In for Pricing
View Details