Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY86 Peptide - middle region

LY86 Peptide - middle region

Product Specifications

Product Name Alternative

MD1, MD-1, MMD-1, dJ80N2.1

UniProt

O95711

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004262.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]
TA503927BM 100 µL

SERPINB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF405S conjugate, 0.1mg/mL
BNC042564-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HHLA1 (NM_001145095) Human Over-expression Lysate
LY428685 100 µg

HHLA1 (NM_001145095) Human Over-expression Lysate

Sign In for Pricing
View Details
CD20 (B9E9), 0.2mg/mL
BNUB0160-100 1x 100 µL

CD20 (B9E9), 0.2mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF594 conjugate, 0.1mg/mL
BNC942052-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
AP32983SU-N 100 µL

Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details