LY86 Peptide - middle region
LY86 Peptide - middle region
Product Specifications
Product Name Alternative
MD1, MD-1, MMD-1, dJ80N2.1
UniProt
O95711
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_004262.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881224-100 1x 100 µL
HCG-beta (HCGb/54+ HCGb/459), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042441-100 1x 100 µL
GATA-3 (Breast and Urothelial Marker) (GATA3/2441), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH033088-01 10 µg
Recombinant Human Sulfotransferase/SULT1C4 Protein (His Tag)
Sign In for Pricing
View Details PKSH033088-02 50 µg
Recombinant Human Sulfotransferase/SULT1C4 Protein (His Tag)
Sign In for Pricing
View Details 
PKSQ050042-01 10 µg
Recombinant Cynomolgus CTLA-4/CD152 Protein (Fc Tag)
Sign In for Pricing
View Details