Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK11 Peptide - middle region

KLK11 Peptide - middle region

Product Specifications

Product Name Alternative

TLSP, PRSS20

UniProt

Q9UBX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001129504.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 (BCL2/782 + BCL2/796), CF594 conjugate, 0.1mg/mL
BNC941023-100 1x 100 µL

Bcl-2 (BCL2/782 + BCL2/796), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aluminum tert-Butoxide
TRC-A575890-25G 25 g

Aluminum tert-Butoxide

Sign In for Pricing
View Details
Crude Trifolium repens Lectin (White Clover) -RTA-20mg
L-5800-20 20 mg

Crude Trifolium repens Lectin (White Clover) -RTA-20mg

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF640R conjugate, 0.1mg/mL
BNC400693-100 1x 100 µL

CD56 / NCAM (123C3.D5 + 123A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nedd8 (NM_008683) Mouse Tagged ORF Clone
MG200148 10 µg

Nedd8 (NM_008683) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF740 conjugate, 0.1mg/mL
BNC741060-500 1x 500 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details