Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK11 Peptide - middle region

KLK11 Peptide - middle region

Product Specifications

Product Name Alternative

TLSP, PRSS20

UniProt

Q9UBX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001129504.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Pan (MHC II) (rHLA-Pan/3475), CF647 conjugate, 0.1mg/mL
BNC473475-500 1x 500 µL

HLA-Pan (MHC II) (rHLA-Pan/3475), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT5B (STAT5B/2657), CF740 conjugate, 0.1mg/mL
BNC742657-500 1x 500 µL

STAT5B (STAT5B/2657), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDE4 (PDE4B) (NM_001037341) Human Over-expression Lysate
LY421908 100 µg

PDE4 (PDE4B) (NM_001037341) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Dydc2 activation kit by CRISPRa
GA208761 1 Kit

Mouse Dydc2 activation kit by CRISPRa

Sign In for Pricing
View Details
5-Androsten-3b-ol-17-one Ethyleneketal-d8
TRC-A637947-25MG 25 mg

5-Androsten-3b-ol-17-one Ethyleneketal-d8

Sign In for Pricing
View Details
Dehydroepiandrosterone Sulfate-7-Cmo
TRC-D910810-100MG 100 mg

Dehydroepiandrosterone Sulfate-7-Cmo

Sign In for Pricing
View Details