Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND2D Peptide - middle region

DENND2D Peptide - middle region

Product Specifications

UniProt

Q9H6A0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001258762.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEYLLVVSLKKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAIPLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Mre11 (Ser678) Rabbit Polyclonal Antibody (Cy7)
orb1070905 100 µL

Phospho-Mre11 (Ser678) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA)
MBS1322656-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA)
MBS1322656-02 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA)
MBS1322656-03 1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA)
MBS1322656-04 5x 1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA)

Sign In for Pricing
View Details
Spike RBD-SD1 Protein (C-His, SARS-CoV-2)
P518533 100 µg

Spike RBD-SD1 Protein (C-His, SARS-CoV-2)

Sign In for Pricing
View Details