Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA13 Peptide - middle region

HSPA13 Peptide - middle region

Product Specifications

Product Name Alternative

STCH

UniProt

P48723

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_008879.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Amino-1H-pyrazolo[4,3-c]pyridine
OR305336 100 mg

6-Amino-1H-pyrazolo[4,3-c]pyridine

Sign In for Pricing
View Details
Rat serpin peptidase inhibitor, clade B (ovalbumin), member 7 (SERPINB7) ELISA Kit
EIA07739r 1 Kit

Rat serpin peptidase inhibitor, clade B (ovalbumin), member 7 (SERPINB7) ELISA Kit

Sign In for Pricing
View Details
Cped1 Mouse qPCR Primer Pair (NM_001081351)
MP214390 200 Reactions

Cped1 Mouse qPCR Primer Pair (NM_001081351)

Sign In for Pricing
View Details
MYCN CRISPR All-in-one AAV vector set (with saCas9)(Rat)
31216156 3x 1.0 µg DNA

MYCN CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
FAM213B Protein Vector (Rat) (pPM-C-HA)
PV267476 500 ng

FAM213B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Rat Ubiquitin carboxyl-terminal hydrolase 21 (Usp21)
MBS1061081-01 0.02 mg (E-Coli)

Recombinant Rat Ubiquitin carboxyl-terminal hydrolase 21 (Usp21)

Sign In for Pricing
View Details