What is the catalog number for EHD2 Peptide - N-terminal region?

The catalog number for EHD2 Peptide - N-terminal region is orb2001231.

What sizes are available for EHD2 Peptide - N-terminal region?

EHD2 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is EHD2 Peptide - N-terminal region in stock?

EHD2 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

EHD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAST2

UniProt

Q9NZN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055416.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDKPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2715476-01 50 µL

Ubinuclein 1 Rabbit pAb

Sign In for Pricing

View Details

orb2715476-02 100 µL

Ubinuclein 1 Rabbit pAb

Sign In for Pricing

View Details

NBP2-97274AF700 0.1 mL

Rabbit Polyclonal PKD2L2 Antibody [Alexa Fluor 700]

Sign In for Pricing

View Details

MBS9440228-01 0.1 mL (Biotin)

HIGD1A Polyclonal Conjugated Antibody

Sign In for Pricing

View Details

MBS9440228-02 0.1 mL (AF350)

HIGD1A Polyclonal Conjugated Antibody

Sign In for Pricing

View Details

MBS9440228-03 0.1 mL (AF405)

HIGD1A Polyclonal Conjugated Antibody

Sign In for Pricing

View Details