Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBD1 Peptide - middle region

TUBD1 Peptide - middle region

Product Specifications

Product Name Alternative

TUBD

UniProt

Q9UJT1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001180538.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HACFCQKQGSGNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFSGFFIIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant C16orf89 Antibody
RN-14749-01 50 μL

Recombinant C16orf89 Antibody

Sign In for Pricing
View Details
Recombinant C16orf89 Antibody
RN-14749-02 100 µL

Recombinant C16orf89 Antibody

Sign In for Pricing
View Details
Recombinant C16orf89 Antibody
RN-14749-03 1 mL

Recombinant C16orf89 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR561014 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
4-Chloro Resorcinol-13C6
TRC-C381502-1MG 1 mg

4-Chloro Resorcinol-13C6

Sign In for Pricing
View Details
Lmo1 (NM_057173) Mouse Tagged ORF Clone
MG201171 10 µg

Lmo1 (NM_057173) Mouse Tagged ORF Clone

Sign In for Pricing
View Details