Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBD1 Peptide - middle region

TUBD1 Peptide - middle region

Product Specifications

Product Name Alternative

TUBD

UniProt

Q9UJT1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001180538.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HACFCQKQGSGNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFSGFFIIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(3-Pyridyl)-1,4-butanediol
TRC-P992500-5MG 5 mg

1-(3-Pyridyl)-1,4-butanediol

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR561662 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
TSR1 Rabbit Polyclonal Antibody
TA382913 100 µL

TSR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc22a27 Mouse Gene Knockout Kit (CRISPR)
KN515936 1 Kit

Slc22a27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Arvcf activation kit by CRISPRa
GA200291 1 Kit

Mouse Arvcf activation kit by CRISPRa

Sign In for Pricing
View Details
Sdf2 Mouse Gene Knockout Kit (CRISPR)
KN515427 1 Kit

Sdf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details