Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA7 Peptide - middle region

PSMA7 Peptide - middle region

Product Specifications

Product Name Alternative

C6, HSPC, RC6-1, XAPC7

UniProt

O14818

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002783.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C7orf52 (NAT16) activation kit by CRISPRa
GA117825 1 Kit

Human C7orf52 (NAT16) activation kit by CRISPRa

Sign In for Pricing
View Details
CD45RA (111-1C5), 0.2mg/mL
BNUB1038-500 1x 500 µL

CD45RA (111-1C5), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS641393 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
GJB6 (NM_001110220) Human Over-expression Lysate
LY426317 100 µg

GJB6 (NM_001110220) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ST20 activation kit by CRISPRa
GA118268 1 Kit

Human ST20 activation kit by CRISPRa

Sign In for Pricing
View Details
DDX5 (C-term) Rabbit Polyclonal Antibody
AP14107PU-N 400 µL

DDX5 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details