Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA7 Peptide - middle region

PSMA7 Peptide - middle region

Product Specifications

Product Name Alternative

C6, HSPC, RC6-1, XAPC7

UniProt

O14818

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002783.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS800352 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
c-Myc (MYC) pSer373 Rabbit Polyclonal Antibody
AP02337PU-N 100 µL

c-Myc (MYC) pSer373 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MID1IP1 activation kit by CRISPRa
GA111799 1 Kit

Human MID1IP1 activation kit by CRISPRa

Sign In for Pricing
View Details
elF2 alpha (EIF2S1) pSer49 Rabbit Polyclonal Antibody
AP08033PU-N 100 µL

elF2 alpha (EIF2S1) pSer49 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Dysferlin interacting protein 1 (PPP1R27) activation kit by CRISPRa
GA114607 1 Kit

Human Dysferlin interacting protein 1 (PPP1R27) activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF483 Human Gene Knockout Kit (CRISPR)
KN420978 1 Kit

ZNF483 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details