Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM4 Peptide - middle region

GSTM4 Peptide - middle region

Product Specifications

Product Name Alternative

GTM4, GSTM4-4

UniProt

Q03013

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000841.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAG2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2298204 1.0 µg DNA

STAG2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cavy Kelch Domain-Containing Protein 5 (KLHDC5) ELISA Kit
MBS9901374 Inquire

Cavy Kelch Domain-Containing Protein 5 (KLHDC5) ELISA Kit

Sign In for Pricing
View Details
Quick Step Human Protein Z ELISA Kit
QS1486Hu-01 48 Tests

Quick Step Human Protein Z ELISA Kit

Sign In for Pricing
View Details
Quick Step Human Protein Z ELISA Kit
QS1486Hu-02 96 Tests

Quick Step Human Protein Z ELISA Kit

Sign In for Pricing
View Details
WIPI2 Rabbit Polyclonal Antibody
UB-GEN-10100 100 µL

WIPI2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CD70 qPCR Primer Pair
QH01857S 200 Tests

Human CD70 qPCR Primer Pair

Sign In for Pricing
View Details