Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM4 Peptide - middle region

GSTM4 Peptide - middle region

Product Specifications

Product Name Alternative

GTM4, GSTM4-4

UniProt

Q03013

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000841.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transmembrane protein 98 (TMEM98) ELISA Kit
KTE60263-01 48 Tests

Human Transmembrane protein 98 (TMEM98) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 98 (TMEM98) ELISA Kit
KTE60263-02 96 Tests

Human Transmembrane protein 98 (TMEM98) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 98 (TMEM98) ELISA Kit
KTE60263-03 5x 96 Tests

Human Transmembrane protein 98 (TMEM98) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 98 (TMEM98) ELISA Kit
KTE60263-04 50x 96 Tests

Human Transmembrane protein 98 (TMEM98) ELISA Kit

Sign In for Pricing
View Details
Bovine Cytoplasmic FMR1-interacting protein 1, CYFIP1 ELISA KIT
ELI-09088b 96 Tests

Bovine Cytoplasmic FMR1-interacting protein 1, CYFIP1 ELISA KIT

Sign In for Pricing
View Details
Matrilin-2 (2B8)
sc-293397 100 µg/mL

Matrilin-2 (2B8)

Sign In for Pricing
View Details