Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL3L Peptide - middle region

RPL3L Peptide - middle region

Product Specifications

UniProt

Q92901

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005052.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Flat, Multi-hole, 200 Mesh, Gold, (100/pk)
M-CF4MH-100-Au 100 Grids

C-Flat, Multi-hole, 200 Mesh, Gold, (100/pk)

Sign In for Pricing
View Details
CCR4 sgRNA CRISPR Lentivector (Human) (Target 1)
K0395002 1.0 µg DNA

CCR4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Adenosine A3-R (m) -PR
sc-39855-PR 10 µM - 20 µL

Adenosine A3-R (m) -PR

Sign In for Pricing
View Details
CACNA1C Protein Vector (Mouse) (pPM-C-HA)
PV160788 500 ng

CACNA1C Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lamtor5 Mouse qPCR Primer Pair (NM_026774)
MP220040 200 Reactions

Lamtor5 Mouse qPCR Primer Pair (NM_026774)

Sign In for Pricing
View Details
Feline Leukemia Virus, gp70 (FeLV) (PE)
MBS6262894-01 0.1 mL

Feline Leukemia Virus, gp70 (FeLV) (PE)

Sign In for Pricing
View Details